MZT2B (NM_025029) Human Recombinant Protein

MZT2B protein,

Recombinant protein of human family with sequence similarity 128, member B (FAM128B)

Product Info Summary

SKU: PROTQ6NZ67
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MZT2B (NM_025029) Human Recombinant Protein

View all MZT2B recombinant proteins

SKU/Catalog Number

PROTQ6NZ67

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human family with sequence similarity 128, member B (FAM128B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MZT2B (NM_025029) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6NZ67)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16 kDa

Amino Acid Sequence

MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALALAERSSREGSSQRMPRQPSATRLPKGGGPGKSPTRGST

Validation Images & Assay Conditions

Gene/Protein Information For MZT2B (Source: Uniprot.org, NCBI)

Gene Name

MZT2B

Full Name

Mitotic-spindle organizing protein 2B

Weight

16 kDa

Superfamily

MOZART2 family

Alternative Names

Mitotic-spindle organizing protein 2B MZT2B FAM128B, MOZART2B mitotic spindle organizing protein 2B mitotic-spindle organizing protein 2B|family with sequence similarity 128, member B|mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MZT2B, check out the MZT2B Infographic

MZT2B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MZT2B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6NZ67

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MZT2B (NM_025029) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MZT2B (NM_025029) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MZT2B (NM_025029) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6NZ67
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.