MYL7 (NM_021223) Human Recombinant Protein

Myl7 protein,

Product Info Summary

SKU: PROTQ01449
Size: 20 µg
Source: HEK293T

Product Name

MYL7 (NM_021223) Human Recombinant Protein

View all Myl7 recombinant proteins

SKU/Catalog Number

PROTQ01449

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human myosin, light chain 7, regulatory (MYL7)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MYL7 (NM_021223) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ01449)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.3 kDa

Amino Acid Sequence

MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE

Validation Images & Assay Conditions

Gene/Protein Information For MYL7 (Source: Uniprot.org, NCBI)

Gene Name

MYL7

Full Name

Myosin regulatory light chain 2, atrial isoform

Weight

19.3 kDa

Alternative Names

atrial isoform; light polypeptide 7, regulatory; MLC-2a; MYL2A; MYLC2AMLC2a; myosin, light chain 7, regulatory Myl7|MLC, MLC-2, MLC-2alpha, MLC2a, MYL2A, Mylc, Mylc2a, RL, RLC-A|myosin, light polypeptide 7, regulatory|myosin regulatory light chain 2, atrial isoform|MLC-2a|myosin light chain 2a|myosin light chain, regulatory A|myosin regulatory light chain 7

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MYL7, check out the MYL7 Infographic

MYL7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MYL7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ01449

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MYL7 (NM_021223) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MYL7 (NM_021223) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MYL7 (NM_021223) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ01449
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.