RCN1 (NM_002901) Human Recombinant Protein

RCN1 protein,

Product Info Summary

SKU: PROTQ15293
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RCN1 (NM_002901) Human Recombinant Protein

View all RCN1 recombinant proteins

SKU/Catalog Number

PROTQ15293

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human reticulocalbin 1, EF-hand calcium binding domain (RCN1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RCN1 (NM_002901) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15293)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35.8 kDa

Amino Acid Sequence

MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Validation Images & Assay Conditions

Gene/Protein Information For RCN1 (Source: Uniprot.org, NCBI)

Gene Name

RCN1

Full Name

Reticulocalbin-1

Weight

35.8 kDa

Superfamily

CREC family

Alternative Names

FLJ37041; FLJ55835; PIG20; proliferation-inducing gene 20; RCAL; RCN; reticulocalbin 1, EF-hand calcium binding domain; reticulocalbin-1 RCN1 HEL-S-84, PIG20, RCAL, RCN reticulocalbin 1 reticulocalbin-1|epididymis secretory protein Li 84|proliferation-inducing gene 20|reticulocalbin 1, EF-hand calcium binding domain

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RCN1, check out the RCN1 Infographic

RCN1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RCN1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ15293

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RCN1 (NM_002901) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RCN1 (NM_002901) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RCN1 (NM_002901) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ15293
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.