MYL12B (NM_001144946) Human Recombinant Protein

MRLC2 protein,

Product Info Summary

SKU: PROTO14950
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MYL12B (NM_001144946) Human Recombinant Protein

View all MRLC2 recombinant proteins

SKU/Catalog Number

PROTO14950

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens myosin, light chain 12B, regulatory (MYL12B), transcript variant 4

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MYL12B (NM_001144946) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO14950)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.6 kDa

Amino Acid Sequence

MSSMFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For MYL12B (Source: Uniprot.org, NCBI)

Gene Name

MYL12B

Full Name

Myosin regulatory light chain 12B

Weight

17.6 kDa

Alternative Names

MLC-2; MLC20; MLC-2A; MLC-B; MRLC2SHUJUN-1; MYLC2B; myosin regulatory light chain 12B; myosin regulatory light chain 2; Myosin regulatory light chain 20 kDa; Myosin regulatory light chain 2-B, smooth muscle isoform; Myosin regulatory light chain MRLC2; myosin, light chain 12B, regulatory Myl12b|Mrlc2, Mrlcb, Mylc2b|myosin light chain 12B|myosin regulatory light chain 12B|MLC-2|MLC20|myosin RLC-B|myosin light chain, regulatory B|myosin regulatory light chain 20 kDa|myosin regulatory light chain MRLC2|myosin regulatory light chain-B|myosin, light chain 12B, regulatory

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MYL12B, check out the MYL12B Infographic

MYL12B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MYL12B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO14950

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MYL12B (NM_001144946) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MYL12B (NM_001144946) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MYL12B (NM_001144946) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO14950
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.