MX1 Myxovirus Resistance 1 Bovine Recombinant Protein

MxA/Mx1 protein, Bovine

MX1 Bovine Recombinant fused with a 20 amino acid His tag at N-terminus produced in E. coli is a single, non-glycosylated, polypeptide chain (1-648 a.a) containing a total of 668 amino acids and having a molecular mass of 77kDa. The MX1 is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTP79135
Size: 5ug, 20ug, 1mg
Origin Species: Bovine
Source: Escherichia coli

Product Name

MX1 Myxovirus Resistance 1 Bovine Recombinant Protein

View all MxA/Mx1 recombinant proteins

SKU/Catalog Number

PROTP79135

Size

5ug, 20ug, 1mg

Description

MX1 Bovine Recombinant fused with a 20 amino acid His tag at N-terminus produced in E. coli is a single, non-glycosylated, polypeptide chain (1-648 a.a) containing a total of 668 amino acids and having a molecular mass of 77kDa. The MX1 is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized MX1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MX1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Cite This Product

MX1 Myxovirus Resistance 1 Bovine Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP79135)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

The MX1 protein was lyophilized from a (1mg/ml) 0.2µm filtered solution containing 20mM Tris-HCl, pH7.9, 500mM NaCl, 0.5mM Imidazole, 0.1mM DTT and 6M urea.

Purity

Greater than 90.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.

Reconstitution

It is recommended to reconstitute the lyophilized MX1 in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

MVHSDLGIEELDSPESSLNGSEDMESKSNLYSQYEEKVRPCID LIDSLRSLGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLRLKKLGNE DEWKGKVSFLDKEIEIPDASQVEKEISEAQIAIAGEGTGISHELISLEVSSPHVPDLTLIDLP GITRVAVGNQPPDIEYQIKSLIRKYILRQETINLVVVPANVDIATTEALRMAQEVDPQGDRTI GILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQDIKHRMSLDKALQRERIFFEDH AHFRDLLEEGKATIPCLAERLTSELIMHICKTLPLLENQIKETHQRITEELQKYGKDIPEEES EKMFCLIEKIDTFNKEIISTIEGEEFVEQYDSRLFTKVRAEFSKWSAVVEKNFEKGYEAIRKE IKQFENRYRGRELPGFVNYKTFETIIKKQVRVLEEPAVDMLHTVTDIIRNTFTDVSGKHFNEF FNLHRTAKSKIEDIRLEQENEAEKSIRLHFQMEQLVYCQDQVYRRALQQVREKEAEEEKNKKS NHYFQSQVSEPSTDEIFQHLTAYQQEVSTRISGHIPLIIQFFVLRTYGEQLKKSMLQLLQDKD QYDWLLKERTDTRDKRKFLKERLERLTRARQRLAKFPG

Reconstitution

It is recommended to reconstitute the lyophilized MX1 in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For MX1 (Source: Uniprot.org, NCBI)

Gene Name

MX1

Full Name

Interferon-induced GTP-binding protein Mx1

Weight

Superfamily

TRAFAC class dynamin-like GTPase superfamily

Alternative Names

human interferon-regulated resistance GTP-binding protein MXA10IFI-78Khomolog of murine (interferon-inducibleprotein p78); IFI78; IFI-78K; Mx1; MxA; myxovirus (influenza virus) resistance 1, interferon-inducible protein p78(mouse) MX1 IFI-78K, IFI78, MX, MxA, lncMX1-215 MX dynamin like GTPase 1 interferon-induced GTP-binding protein Mx1|interferon-induced protein p78|interferon-inducible protein p78|interferon-regulated resistance GTP-binding protein MxA|myxoma resistance protein 1|myxovirus (influenza virus) resistance 1, interferon-inducible protein p78

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MX1, check out the MX1 Infographic

MX1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MX1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP79135

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MX1 Myxovirus Resistance 1 Bovine Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MX1 Myxovirus Resistance 1 Bovine Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MX1 Myxovirus Resistance 1 Bovine Recombinant Protein

Size

Total: $250

SKU:PROTP79135

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTP79135
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.