MTFR1L (NM_019557) Human Recombinant Protein

FAM54B protein,

Recombinant protein of human family with sequence similarity 54, member B (FAM54B), transcript variant 1

Product Info Summary

SKU: PROTQ9H019
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MTFR1L (NM_019557) Human Recombinant Protein

View all FAM54B recombinant proteins

SKU/Catalog Number

PROTQ9H019

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human family with sequence similarity 54, member B (FAM54B), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MTFR1L (NM_019557) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H019)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

31.8 kDa

Amino Acid Sequence

MSGMEATVTIPIWQNKPHGAARSVVRRIGTNLPLKPCARASFETLPNISDLCLRDVPPVPTLADIAWIAADEEETYARVRSDTRPLRHTWKPSPLIVMQRNASVPNLRGSEERLLALKKPALPALSRTTELQDELSHLRSQIAKIVAADAASASLTPDFLSPGSSNVSSPLPCFGSSFHSTTSFVISDITEETEVEVPELPSVPLLCSASPECCKPEHKAACSSSEEDDCVSLSKASSFADMMGILKDFHRMKQSQDLNRSLLKEEDPAVLISEVLRRKFALKEEDISRKGN

Validation Images & Assay Conditions

Gene/Protein Information For MTFR1L (Source: Uniprot.org, NCBI)

Gene Name

MTFR1L

Full Name

Mitochondrial fission regulator 1-like

Weight

31.8 kDa

Superfamily

MTFR1 family

Alternative Names

family with sequence similarity 54, member B; hypothetical protein LOC56181; MST116; MSTP116 MTFR1L FAM54B, HYST1888, MST116, MSTP116 mitochondrial fission regulator 1 like mitochondrial fission regulator 1-like|family with sequence similarity 54 member B|protein FAM54B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MTFR1L, check out the MTFR1L Infographic

MTFR1L infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MTFR1L: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H019

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MTFR1L (NM_019557) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MTFR1L (NM_019557) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MTFR1L (NM_019557) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H019
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.