MTCP1 (NM_001018025) Human Recombinant Protein

MTCP1 protein,

Product Info Summary

SKU: PROTP56278
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MTCP1 (NM_001018025) Human Recombinant Protein

View all MTCP1 recombinant proteins

SKU/Catalog Number

PROTP56278

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mature T-cell proliferation 1 (MTCP1), nuclear gene encoding mitochondrial protein, transcript variant B1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MTCP1 (NM_001018025) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP56278)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.4 kDa

Amino Acid Sequence

MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD

Validation Images & Assay Conditions

Gene/Protein Information For MTCP1 (Source: Uniprot.org, NCBI)

Gene Name

MTCP1

Full Name

Protein p13 MTCP-1

Weight

12.4 kDa

Superfamily

TCL1 family

Alternative Names

mature T-cell proliferation 1; P13MTCP1 MTCP1 P13MTCP1, TCL1C, p8MTCP1 mature T cell proliferation 1 protein p13 MTCP-1|MTCP-1 type B1|TCL1 family AKT coactivator C|mature T-cell proliferation-1 type B1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MTCP1, check out the MTCP1 Infographic

MTCP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MTCP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP56278

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MTCP1 (NM_001018025) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MTCP1 (NM_001018025) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MTCP1 (NM_001018025) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP56278
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product