MRPS11 (NM_022839) Human Recombinant Protein

MRPS11 protein,

Recombinant protein of human mitochondrial ribosomal protein S11 (MRPS11), nuclear gene encoding mitochondrial protein, transcript variant 1

Product Info Summary

SKU: PROTP82912
Size: 20 µg
Source: HEK293T

Product Name

MRPS11 (NM_022839) Human Recombinant Protein

View all MRPS11 recombinant proteins

SKU/Catalog Number

PROTP82912

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mitochondrial ribosomal protein S11 (MRPS11), nuclear gene encoding mitochondrial protein, transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MRPS11 (NM_022839) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP82912)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.4 kDa

Amino Acid Sequence

MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL

Validation Images & Assay Conditions

Gene/Protein Information For MRPS11 (Source: Uniprot.org, NCBI)

Gene Name

MRPS11

Full Name

28S ribosomal protein S11, mitochondrial

Weight

20.4 kDa

Superfamily

universal ribosomal protein uS11 family

Alternative Names

28S ribosomal protein S11, mitochondrial; Cervical cancer proto-oncogene 2 protein; FLJ22512; FLJ23406; HCC-2S11mt; mitochondrial ribosomal protein S11; MRP-S11; RPMS11 MRPS11 HCC-2, MRP-S11, S11mt mitochondrial ribosomal protein S11 28S ribosomal protein S11, mitochondrial|cervical cancer proto-oncogene 2 protein|mitochondrial small ribosomal subunit protein uS11m

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MRPS11, check out the MRPS11 Infographic

MRPS11 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MRPS11: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP82912

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MRPS11 (NM_022839) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MRPS11 (NM_022839) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MRPS11 (NM_022839) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP82912
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.