MRPL28 (NM_006428) Human Recombinant Protein

MRPL28 protein,

Product Info Summary

SKU: PROTQ13084
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MRPL28 (NM_006428) Human Recombinant Protein

View all MRPL28 recombinant proteins

SKU/Catalog Number

PROTQ13084

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mitochondrial ribosomal protein L28 (MRPL28), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MRPL28 (NM_006428) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13084)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30 kDa

Amino Acid Sequence

MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ

Validation Images & Assay Conditions

Gene/Protein Information For MRPL28 (Source: Uniprot.org, NCBI)

Gene Name

MRPL28

Full Name

39S ribosomal protein L28, mitochondrial

Weight

30 kDa

Superfamily

bacterial ribosomal protein bL28 family

Alternative Names

L28mt; MAAT139S ribosomal protein L28, mitochondrial; Melanoma antigen p15; melanoma-associated antigen recognised by cytotoxic T lymphocytes; Melanoma-associated antigen recognized by T lymphocytes; MGC8499; mitochondrial ribosomal protein L28; MRP-L28; p15 MRPL28 MAAT1, p15 mitochondrial ribosomal protein L28 39S ribosomal protein L28, mitochondrial|L28mt|MRP-L28|melanoma antigen p15|melanoma-associated antigen recognised by cytotoxic T lymphocytes|melanoma-associated antigen recognized by T-lymphocytes|mitochondrial large ribosomal subunit protein bL28m

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MRPL28, check out the MRPL28 Infographic

MRPL28 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MRPL28: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13084

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MRPL28 (NM_006428) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MRPL28 (NM_006428) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MRPL28 (NM_006428) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13084
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.