MRAS (NM_012219) Human Recombinant Protein

M-Ras/R-Ras3 protein,

Product Info Summary

SKU: PROTO14807
Size: 20 µg
Source: HEK293T

Product Name

MRAS (NM_012219) Human Recombinant Protein

View all M-Ras/R-Ras3 recombinant proteins

SKU/Catalog Number

PROTO14807

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human muscle RAS oncogene homolog (MRAS), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MRAS (NM_012219) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO14807)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.7 kDa

Amino Acid Sequence

MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITREQGKEMATKHNTPYIETSAKDPPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDRATGTHKLQCVIL

Validation Images & Assay Conditions

Gene/Protein Information For MRAS (Source: Uniprot.org, NCBI)

Gene Name

MRAS

Full Name

Ras-related protein M-Ras

Weight

23.7 kDa

Superfamily

small GTPase superfamily

Alternative Names

FLJ42964; MRas; M-Ras; muscle and microspikes RAS; muscle RAS oncogene homolog; ras-related protein M-Ras; Ras-related protein R-Ras3; R-RAS3; RRAS3M-RAs Mras|2900078C09Rik, AI326250|muscle and microspikes RAS|ras-related protein M-Ras|X-Ras|ras-related protein R-Ras3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MRAS, check out the MRAS Infographic

MRAS infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MRAS: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO14807

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MRAS (NM_012219) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MRAS (NM_012219) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MRAS (NM_012219) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO14807
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.