Mouse recombinant VEGF165 (Vascular endothelial growth factor 165) protein, AF

VEGFA protein, Mouse

Vascular Endothelial Growth Factors 165 (VEGF165) is a potent growth and angiogenic cytokine which belongs to the VEGF family, includes VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, and PIGF. VEGF165 is an abundant glycosylated cytokine composed of two identical 165 amino acid chains. VEGF165 plays an important role in embryonic vasculogenesis, angiogenesis and neurogenesis.

Product Info Summary

SKU: PROTQ00731-7
Size: 5ug,20ug,100ug
Origin Species: Mouse
Source: Escherichia coli
Application: Cell Culture

Product Name

Mouse recombinant VEGF165 (Vascular endothelial growth factor 165) protein, AF

View all VEGFA recombinant proteins

SKU/Catalog Number

PROTQ00731-7

Size

5ug,20ug,100ug

Tag

His Tag (C-term)

Description

Vascular Endothelial Growth Factors 165 (VEGF165) is a potent growth and angiogenic cytokine which belongs to the VEGF family, includes VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, and PIGF. VEGF165 is an abundant glycosylated cytokine composed of two identical 165 amino acid chains. VEGF165 plays an important role in embryonic vasculogenesis, angiogenesis and neurogenesis.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Mouse recombinant VEGF165 (Vascular endothelial growth factor 165) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ00731-7)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

27.042kDa

Molecular weight

The protein has a calculated MW of 20.22 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce proliferation in HUVEC cells. The ED₅₀ for this effect is <3 ng/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For VEGFA (Source: Uniprot.org, NCBI)

Gene Name

VEGFA

Full Name

Vascular endothelial growth factor A

Weight

27.042kDa

Superfamily

PDGF/VEGF growth factor family

Alternative Names

VPF, Folliculostellate cell-derived growth factor, Glioma-derived endothelial cell mitogen VEGFA MVCD1, VEGF, VPF vascular endothelial growth factor A vascular endothelial growth factor A|vascular endothelial growth factor A121|vascular endothelial growth factor A165|vascular permeability factor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on VEGFA, check out the VEGFA Infographic

VEGFA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for VEGFA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used Mouse recombinant VEGF165 (Vascular endothelial growth factor 165) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse recombinant VEGF165 (Vascular endothelial growth factor 165) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse recombinant VEGF165 (Vascular endothelial growth factor 165) protein, AF

Size

Total: $77

SKU:PROTQ00731-7

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTQ00731-7
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.