Click image to see more details
Product Info Summary
| SKU: | PROTQ00731-6 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant VEGF121 (Vascular endothelial growth factor 121) protein, AF
View all VEGFA recombinant proteins
SKU/Catalog Number
PROTQ00731-6
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Vascular Endothelial Growth Factors 121 (VEGF121) is a truncated version of VEGF165, which produced in E. coli is a homodimer, non-glycosylated, polypeptide chain and having a molecular mass of 28.4 kDa. There is three different isoforms (120, 164 and 188 a.a.) found in mouse. VEGF 121 shows that lack basic heparin-binding regions and are freely diffusible. Mouse VEGF121 shares 98% identity with corresponding regions of rat, 89% with canine, feline, equine and porcine, and 87% with human, ovine and bovine VEGF, respectively.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant VEGF121 (Vascular endothelial growth factor 121) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ00731-6)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
27.042kDa
Molecular weight
The protein has a calculated MW of 15.01 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce proliferation in HUVEC cells. The ED₅₀ for this effect is <3 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse VEGF121
Protein Target Info & Infographic
Gene/Protein Information For Vegfa (Source: Uniprot.org, NCBI)
Gene Name
Vegfa
Full Name
Vascular endothelial growth factor A
Weight
27.042kDa
Superfamily
PDGF/VEGF growth factor family
Alternative Names
VPF VEGFA MVCD1, VEGF, VPF vascular endothelial growth factor A vascular endothelial growth factor A|vascular endothelial growth factor A121|vascular endothelial growth factor A165|vascular permeability factor
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on Vegfa, check out the Vegfa Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Vegfa: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant VEGF121 (Vascular endothelial growth factor 121) protein, AF (PROTQ00731-6)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant VEGF121 (Vascular endothelial growth factor 121) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant VEGF121 (Vascular endothelial growth factor 121) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
