Click image to see more details
Product Info Summary
| SKU: | PROTO54907 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant TWEAK (TNF-related weak inducer of apoptosis) protein, AF
View all TWEAK/TNFSF12 recombinant proteins
SKU/Catalog Number
PROTO54907
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
TNF-related Weak Inducer of Apoptosis (TWEAK) is a type II membrane protein of the tumor necrosis factor (TNF) family members, high levels expression in mouse peritoneal macrophages. The murine and human TWEAK homologs are very close related (~93% sequence identity in the receptor-binding domain). TWEAK is a 17.3 kDa protein containing 129 residues. TWEAK induce apoptosis through cognate receptor Fn14 activate caspase-8 and caspase-3, in HSC3 cells KATO-III gastric adenocarcinoma cells and IFN-γ-treated HT-29. TWEAK stimulate inflammatory cytokines in HT-29, A375 cells, WI-38 fibroblast sand astrocytes.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant TWEAK (TNF-related weak inducer of apoptosis) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO54907)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
27.216kDa
Molecular weight
The protein has a calculated MW of 18.14 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce proliferation in HUVEC cells. The ED₅₀ for this effect is <0.2 μg/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MSAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse TWEAK
Protein Target Info & Infographic
Gene/Protein Information For TNFSF12 (Source: Uniprot.org, NCBI)
Gene Name
TNFSF12
Full Name
Tumor necrosis factor ligand superfamily member 12
Weight
27.216kDa
Superfamily
tumor necrosis factor family
Alternative Names
TNFSF12, DR3LG, Apo3 Ligand, AI255180, C87282, Fn1, Fn14, HPIP, TWEAK-R, Twea, TweakR, Tnfrsf12a TNFSF12 APO3L, DR3LG, TNLG4A, TWEAK TNF superfamily member 12 tumor necrosis factor ligand superfamily member 12|APO3 ligand|APO3/DR3 ligand|TNF-related WEAK inducer of apoptosis|tumor necrosis factor (ligand) superfamily, member 12|tumor necrosis factor ligand 4A|tumor necrosis factor superfamily member 12
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on TNFSF12, check out the TNFSF12 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for TNFSF12: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant TWEAK (TNF-related weak inducer of apoptosis) protein, AF (PROTO54907)
Hello CJ!
No publications found for PROTO54907
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant TWEAK (TNF-related weak inducer of apoptosis) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant TWEAK (TNF-related weak inducer of apoptosis) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
