Click image to see more details
Product Info Summary
| SKU: | PROTP43488-1 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant OX40L protein, AF
View all OX40 Ligand/TNFSF4 recombinant proteins
SKU/Catalog Number
PROTP43488-1
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
OX40L is a 16.86 kDa tumor necrosis factor family protein with 150 amino acid residues. OX40L is mainly expressed from lymphoid tissue, and promotes T-cell proliferation, survival, activation and cytokine production through receptor binding on the surface of T cells (OX40).
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant OX40L protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP43488-1)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
21.05kDa
Molecular weight
The protein has a calculated MW of 17.68 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce IL-2 secretion in mouse T cells in the presence of the anti-CD3 antibody. The ED₅₀ for this effect is <25 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
QLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse OX40L
Protein Target Info & Infographic
Gene/Protein Information For TNFSF4 (Source: Uniprot.org, NCBI)
Gene Name
TNFSF4
Full Name
Tumor necrosis factor ligand superfamily member 4
Weight
21.05kDa
Superfamily
tumor necrosis factor family
Alternative Names
TNFSF4,Ath, Ath-, Ath-1, Ath1, CD134, CD134L, OX-40L, OX4, TXGP1, Tnlg2b, Txgp, Txgp1l, gp3, gp34 TNFSF4 CD134L, CD252, GP34, OX-40L, OX4OL, TNLG2B, TXGP1 TNF superfamily member 4 tumor necrosis factor ligand superfamily member 4|CD134 ligand|OX40 ligand|glycoprotein Gp34|tax-transcriptionally activated glycoprotein 1 (34kD)|tumor necrosis factor (ligand) superfamily member 4|tumor necrosis factor ligand 2B|tumor necrosis factor superfamily member 4
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on TNFSF4, check out the TNFSF4 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for TNFSF4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant OX40L protein, AF (PROTP43488-1)
Hello CJ!
No publications found for PROTP43488-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant OX40L protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant OX40L protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
