Click image to see more details
Product Info Summary
| SKU: | PROTP34884-3 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant MIF (Macrophage migration inhibitory factor) protein, AF
View all MIF recombinant proteins
SKU/Catalog Number
PROTP34884-3
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Macrophage Migration Inhibitory Factor (MIF) is a 12 kDa cytokine with 115 amino acid residues. When MIF binding to CD74 and CD44, downstream signaling pathway (like ERK, AKT and MAPK) will be activated and cause p53 inhibition, cancer proliferation and invasion.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant MIF (Macrophage migration inhibitory factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP34884-3)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
12.476kDa
Molecular weight
The protein has a calculated MW of 13.31 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse MIF
Protein Target Info & Infographic
Gene/Protein Information For Mif (Source: Uniprot.org, NCBI)
Gene Name
Mif
Full Name
Macrophage migration inhibitory factor
Weight
12.476kDa
Superfamily
MIF family
Alternative Names
GLIF, mMIF, GIF, Glycosylation-inhibiting factor, DER6 MIF GIF, GLIF, MMIF macrophage migration inhibitory factor macrophage migration inhibitory factor|L-dopachrome isomerase|L-dopachrome tautomerase|epididymis secretory sperm binding protein|macrophage migration inhibitory factor (glycosylation-inhibiting factor)|phenylpyruvate tautomerase
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on Mif, check out the Mif Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Mif: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant MIF (Macrophage migration inhibitory factor) protein, AF (PROTP34884-3)
Hello CJ!
No publications found for PROTP34884-3
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant MIF (Macrophage migration inhibitory factor) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant MIF (Macrophage migration inhibitory factor) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
