Click image to see more details
Product Info Summary
| SKU: | PROTQ9QYH9-2 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant LIGHT protein, AF
View all LIGHT/TNFSF14 recombinant proteins
SKU/Catalog Number
PROTQ9QYH9-2
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
LIGHT, also known as TNFSF14 is a member of the TNF superfamily that produced by multiple immune cells such as activated T cells and immature dendritic cells (DCs). Mouse LIGHT shares 79% sequence homology with human LIGHT. LIGHT is a 29 kDa type II transmembrane protein, which serves as a ligand for both lymphotoxin β receptor (LTβR) and TNFSF signaling receptors (TNFRSF14/HVEM). Besides, LIGHT can amplify NF-kB signaling pathway in T cells when presencing anti-CD3 antibody treatment. Additionally, LIGHT is able to stimulate T cell proliferation and IFN expression via interacting with TNFRS13 /HVEM.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant LIGHT protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9QYH9-2)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
26.35kDa
Molecular weight
The protein has a calculated MW of 20.92 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce cytotoxicity in HT-29 cells. The ED₅₀ for this effect is <2 μg/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse LIGHT
Protein Target Info & Infographic
Gene/Protein Information For Tnfsf14 (Source: Uniprot.org, NCBI)
Gene Name
Tnfsf14
Full Name
Tumor necrosis factor ligand superfamily member 14
Weight
26.35kDa
Superfamily
tumor necrosis factor family
Alternative Names
TNFSF14, HVEM-L, CD258, Ly113, LTg TNFSF14 CD258, HVEML, LIGHT, LTg TNF superfamily member 14 tumor necrosis factor ligand superfamily member 14|herpesvirus entry mediator ligand|tumor necrosis factor (ligand) superfamily, member 14|tumor necrosis factor ligand 1D|tumor necrosis factor superfamily member 14
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on Tnfsf14, check out the Tnfsf14 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Tnfsf14: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant LIGHT protein, AF (PROTQ9QYH9-2)
Hello CJ!
No publications found for PROTQ9QYH9-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant LIGHT protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant LIGHT protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
