Click image to see more details
Product Info Summary
| SKU: | PROTP20109-2 |
|---|---|
| Size: | 5ug,20ug,100ug,500ug,1mg |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant IL-13 (Interleukin-13) protein, AF
View all IL-13 recombinant proteins
SKU/Catalog Number
PROTP20109-2
Size
5ug,20ug,100ug,500ug,1mg
Tag
His Tag (C-term)
Description
Interleukin 13 (IL-13) with a molecular mass of 10 kDa cytokine, it secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. It is homologous to IL-4 and shares many of its biologic activities on mononuclear phagocytic cells, endothelial cells, epithelial cells, and B cells.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant IL-13 (Interleukin-13) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP20109-2)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
15.816kDa
Molecular weight
The protein has a calculated MW of 13.06 kDa. The protein migrates about 11 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <4 ng/mL. The specific activity of recombinant mouse IL-13 is > 2.5 x 10⁵ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse IL-13
Protein Target Info & Infographic
Gene/Protein Information For IL13 (Source: Uniprot.org, NCBI)
Gene Name
IL13
Full Name
Interleukin-13
Weight
15.816kDa
Superfamily
IL-4/IL-13 family
Alternative Names
P600 IL13 IL-13, P600 interleukin 13 interleukin-13
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL13, check out the IL13 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL13: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant IL-13 (Interleukin-13) protein, AF (PROTP20109-2)
Hello CJ!
No publications found for PROTP20109-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant IL-13 (Interleukin-13) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant IL-13 (Interleukin-13) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
