Product Info Summary
SKU: | PROTP09535 |
---|---|
Size: | 5ug,20ug,100ug |
Origin Species: | Mouse |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant IGF-II (Insulin-like growth factor-II) protein, AF
View all IGF-II/IGF2 recombinant proteins
SKU/Catalog Number
PROTP09535
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
Mouse Insulin Like Growth Factors 2 (IGF-II) is a 7.34 kDa member of the Insulin-like Growth Factors with 67 amino acid residues. IGF-II is mainly expressed from early embryonic somatic tissues, liver, and epithelial cells lining the surface of the brain. IGF-II is mediating the embryonic development and placental growth, while also promoting tumor growth. IGF-II affects regulation of cell proliferation, growth, migration, differentiation and survival via binding to IGF-I receptor.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant IGF-II (Insulin-like growth factor-II) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09535)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
20.14kDa
Molecular weight
The protein has a calculated MW of 8.20 kDa. The protein migrates about 11 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce MCF-7 cells proliferation. The ED₅₀ for this effect is <6 ng/mL. The specific activity of recombinant mouse IGF-II is > 1.5 x 10⁵ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse IGF-II
Protein Target Info & Infographic
Gene/Protein Information For IGF2 (Source: Uniprot.org, NCBI)
Gene Name
IGF2
Full Name
Insulin-like growth factor II
Weight
20.14kDa
Superfamily
insulin family
Alternative Names
AL033362, Igf-2, M6pr, Mpr, Peg, Peg2 IGF2 C11orf43, GRDF, IGF-II, PP9974, SRS3 insulin like growth factor 2 insulin-like growth factor II|T3M-11-derived growth factor|insulin-like growth factor 2 (somatomedin A)|insulin-like growth factor type 2|preptin
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IGF2, check out the IGF2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IGF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant IGF-II (Insulin-like growth factor-II) protein, AF (PROTP09535)
Hello CJ!
No publications found for PROTP09535
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant IGF-II (Insulin-like growth factor-II) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant IGF-II (Insulin-like growth factor-II) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question