Mouse recombinant IFN gamma (Interferon gamma) protein, AF

IFN-gamma protein, Mouse

The cytokine IFN gamma could protect cells from viral infections and belongs to the family of interferons. A lot of studies have shown that IFN gamma secreted by antigen triggered cell types, including T cells, naive CD4+ T cells, macrophages, dendritic cells, and B cells. IFN gamma plays an important role to trigger the macrophage act against a diverse group of microbial targets, and the pleiotropic molecule associated with antiproliferative, pro-apoptotic and antitumor mechanisms. Based on the effector cytokine considered as a major effector of immunity, it has been used in the treatment of several diseases.

Product Info Summary

SKU: PROTP01580-4
Size: 20ug,100ug,500ug,1mg
Origin Species: Mouse
Source: Escherichia coli
Application: Cell Culture

Product Name

Mouse recombinant IFN gamma (Interferon gamma) protein, AF

View all IFN-gamma recombinant proteins

SKU/Catalog Number

PROTP01580-4

Size

20ug,100ug,500ug,1mg

Tag

His Tag (C-term)

Description

The cytokine IFN gamma could protect cells from viral infections and belongs to the family of interferons. A lot of studies have shown that IFN gamma secreted by antigen triggered cell types, including T cells, naive CD4+ T cells, macrophages, dendritic cells, and B cells. IFN gamma plays an important role to trigger the macrophage act against a diverse group of microbial targets, and the pleiotropic molecule associated with antiproliferative, pro-apoptotic and antitumor mechanisms. Based on the effector cytokine considered as a major effector of immunity, it has been used in the treatment of several diseases.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Mouse recombinant IFN gamma (Interferon gamma) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01580-4)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

19.348kDa

Molecular weight

The protein has a calculated MW of 16.5 kDa. The protein migrates as 13-17 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to anti-viral assay in L-929 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <0.5 ng/mL. The specific activity of recombinant mouse IFN gamma is approximately >2x 10⁶ IU/mg.

Endotoxin

<0.01 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For IFNG (Source: Uniprot.org, NCBI)

Gene Name

IFNG

Full Name

Interferon gamma

Weight

19.348kDa

Superfamily

type II (or gamma) interferon family

Alternative Names

Type II interferon, T-cell interferon, MAF, Ifg, If2f, IFN-g IFNG IFG, IFI, IMD69 interferon gamma interferon gamma|IFN-gamma|immune interferon

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IFNG, check out the IFNG Infographic

IFNG infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IFNG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP01580-4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Mouse recombinant IFN gamma (Interferon gamma) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse recombinant IFN gamma (Interferon gamma) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse recombinant IFN gamma (Interferon gamma) protein, AF

Size

Total: $77

SKU:PROTP01580-4

Backordered.

Lead time for this item is typically 2-4 weeks

Get A Quote
In stock
Order Product
PROTP01580-4
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.