Click image to see more details
Product Info Summary
| SKU: | PROTP48540-2 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant GDNF (Glial-derived neurotrophic factor) protein, AF
View all GDNF recombinant proteins
SKU/Catalog Number
PROTP48540-2
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Glial Cell Line-derived Neurotrophic Factor (GDNF) is the neurotrophic factor, belonging to the GDNF family of ligands (GFL) and identifying as a therapeutic candidate in Parkinson's disease. GDNF is a 23.7 kDa protein containing 211 residues that plays a critical role in promoting the survival and differentiation of midbrain dopamine neurons. Besides, GDNF is revealed to facilitate the development of peripheral tissues such as kidney, pancreas and lung. Additionally, as a member of GFL, GDNF also takes part in the progression of tumor.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant GDNF (Glial-derived neurotrophic factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP48540-2)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
23.72kDa
Molecular weight
The protein has a calculated MW of 15.91 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse GDNF
Protein Target Info & Infographic
Gene/Protein Information For GDNF (Source: Uniprot.org, NCBI)
Gene Name
GDNF
Full Name
Glial cell line-derived neurotrophic factor
Weight
23.72kDa
Superfamily
TGF-beta family
Alternative Names
AI385739, ATF GDNF ATF, ATF1, ATF2, HFB1-GDNF, HSCR3 glial cell derived neurotrophic factor glial cell line-derived neurotrophic factor|astrocyte-derived trophic factor
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on GDNF, check out the GDNF Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for GDNF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant GDNF (Glial-derived neurotrophic factor) protein, AF (PROTP48540-2)
Hello CJ!
No publications found for PROTP48540-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant GDNF (Glial-derived neurotrophic factor) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant GDNF (Glial-derived neurotrophic factor) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
