Click image to see more details
Product Info Summary
| SKU: | PROTP18340-1 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF
View all CXCL9/MIG recombinant proteins
SKU/Catalog Number
PROTP18340-1
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
C-X-C motif chemokine 9 (CXCL9) also named monokine induced by gamma interferon (MIG), which is a chemokine of the intercrine alpha family. CXCL9 is a 11.7 kDa protein containing 10? amino acid residues. CXCL9 controls the immune cells by binding the CXCR3 which is including the cell migration and activation. During inflammation, CXCL9 is a chemotaxis for lymphocyte and macrophages. CXCL9 is participated in the process of tumor proliferation and metastasis.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP18340-1)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
14.019kDa
Molecular weight
The protein has a calculated MW of 13.00 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to chemoattract BaF3 cells transfected with mouse CXCR3. The ED₅₀ for this effect is <0.3 μg/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse CXCL9
Protein Target Info & Infographic
Gene/Protein Information For Cxcl9 (Source: Uniprot.org, NCBI)
Gene Name
Cxcl9
Full Name
C-X-C motif chemokine 9
Weight
14.019kDa
Superfamily
intercrine alpha (chemokine CxC) family
Alternative Names
Monokine Induced by Interferon-γ, MIG CXCL9 CMK, Humig, MIG, SCYB9, crg-10 C-X-C motif chemokine ligand 9 C-X-C motif chemokine 9|chemokine (C-X-C motif) ligand 9|gamma-interferon-induced monokine|monokine induced by gamma interferon|monokine induced by interferon-gamma|small-inducible cytokine B9
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on Cxcl9, check out the Cxcl9 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Cxcl9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF (PROTP18340-1)
Hello CJ!
No publications found for PROTP18340-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
