Click image to see more details
Product Info Summary
| SKU: | PROTQ8BSU2-1 |
|---|---|
| Size: | 5ug,20ug,100ug,500ug,1mg |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant CXCL16 (C-X-C motif chemokine 16) protein, AF
View all CXCL16 recombinant proteins
SKU/Catalog Number
PROTQ8BSU2-1
Size
5ug,20ug,100ug,500ug,1mg
Tag
His Tag (N-term)
Description
C-X-C motif chemokine 16 (CXCL16) is a chemokine of the intercrine alpha family which is a 9.8 kDa protein containing 88 amino acid residues. In mediate the innate immunity, CXCL16 is a chemotaxis for T cells and NKT cells, which expressed the CXC chemokine receptor (CXCR) 6. CXCL16 also can be enhanced the expression level by the TNFα, IL-1 and IFNγ. CXCL16 protects the host by against the gram positive and gram negitive bactreials.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant CXCL16 (C-X-C motif chemokine 16) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8BSU2-1)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
27.579kDa
Molecular weight
The protein has a calculated MW of 10.74 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to chemoattract BaF3 cells transfected with mouse CXCR6 The ED₅₀ for this effect is <3 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP with polyhistidine tag at the N-terminus.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse CXCL16
Protein Target Info & Infographic
Gene/Protein Information For CXCL16 (Source: Uniprot.org, NCBI)
Gene Name
CXCL16
Full Name
C-X-C motif chemokine 16
Weight
27.579kDa
Superfamily
intercrine alpha (chemokine CxC) family
Alternative Names
SRPSOX CXCL16 CXCLG16, SR-PSOX, SRPSOX C-X-C motif chemokine ligand 16 C-X-C motif chemokine 16|CXC chemokine ligand 16|chemokine (C-X-C motif) ligand 16|scavenger receptor for phosphatidylserine and oxidized low density lipoprotein|small-inducible cytokine B16|transmembrane chemokine CXCL16
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CXCL16, check out the CXCL16 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CXCL16: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant CXCL16 (C-X-C motif chemokine 16) protein, AF (PROTQ8BSU2-1)
Hello CJ!
No publications found for PROTQ8BSU2-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant CXCL16 (C-X-C motif chemokine 16) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant CXCL16 (C-X-C motif chemokine 16) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
