Click image to see more details
Product Info Summary
| SKU: | PROTP40224-6 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant CXCL12 (C-X-C motif chemokine 12) protein, AF
View all CXCL12 recombinant proteins
SKU/Catalog Number
PROTP40224-6
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
C-X-C motif chemokine 12 (CXCL12) also named stromal cell-derived factor 1 (SDF-1), which is a chemokine of the intercrine alpha family. CXCL12 is a 7.8 kDa protein containing 70 amino acid residues. CXCL12 has a key role in controling the immune responses which is often induced by the lipopolysaccharide or IL-1. CXCL12 also activates the leukocytes during inflammation. CXCL12 induces the migration and proliferation of cells like hematopoietic progenitor, stem cells and leukocytes.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant CXCL12 (C-X-C motif chemokine 12) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP40224-6)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
10.666kDa
Molecular weight
The protein has a calculated MW of 8.97 kDa. The protein migrates below 8-11 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to chemoattract BaF3 cells transfected with human CXCR4. The ED₅₀ for this effect is <0.5 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse CXCL12
Protein Target Info & Infographic
Gene/Protein Information For CXCL12 (Source: Uniprot.org, NCBI)
Gene Name
CXCL12
Full Name
Stromal cell-derived factor 1
Weight
10.666kDa
Superfamily
intercrine alpha (chemokine CxC) family
Alternative Names
PB, PBSF/SD, Pbsf, SDF-, Scyb1, Scyb12, Sdf, Sdf1, TLS, TP, Tlsf, Tpar1 CXCL12 IRH, PBSF, SCYB12, SDF1, TLSF, TPAR1 C-X-C motif chemokine ligand 12 stromal cell-derived factor 1|chemokine (C-X-C motif) ligand 12|intercrine reduced in hepatomas|pre-B cell growth-stimulating factor
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CXCL12, check out the CXCL12 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CXCL12: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant CXCL12 (C-X-C motif chemokine 12) protein, AF (PROTP40224-6)
Hello CJ!
No publications found for PROTP40224-6
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant CXCL12 (C-X-C motif chemokine 12) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant CXCL12 (C-X-C motif chemokine 12) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
