Click image to see more details
Product Info Summary
| SKU: | PROTP51642-2 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant CNTF (Ciliary neurotrophic factor) protein, AF
View all CNTF recombinant proteins
SKU/Catalog Number
PROTP51642-2
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Ciliary Neurotrophic Factor (CNTF) is the member of IL-6 cytokine family and mainly expressed in the nervous system. Mouse CNTF shares 84% sequence homology with human CNTF. CNTF is 22.9 kDa neurotrophic factor containing 110 residues, which shows multiple effects in vertebrate retinogenesis. Besides, CNTF acts as a promoter that not only accelerates adult neurogenesis but also increases the survival of neuron after injury.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant CNTF (Ciliary neurotrophic factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP51642-2)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
22.931kDa
Molecular weight
The protein has a calculated MW of 23.40 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce proliferation in TF-1 cells. The ED₅₀ for this effect is <10 ng/mL. The specific activity of recombinant mouse CNTF is > 1 x 10⁵ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MAFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse CNTF
Protein Target Info & Infographic
Gene/Protein Information For CNTF (Source: Uniprot.org, NCBI)
Gene Name
CNTF
Full Name
Ciliary neurotrophic factor
Weight
22.931kDa
Superfamily
CNTF family
Alternative Names
AI429687 CNTF HCNTF ciliary neurotrophic factor ciliary neurotrophic factor|Ciliary Neuronotrophic Factor
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CNTF, check out the CNTF Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CNTF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant CNTF (Ciliary neurotrophic factor) protein, AF (PROTP51642-2)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant CNTF (Ciliary neurotrophic factor) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant CNTF (Ciliary neurotrophic factor) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
