Mouse recombinant CCL4 (C-C Motif Chemokine Ligand 4) protein, AF

CCL4/MIP-1 beta protein, Mouse

C-C Motif Chemokine Ligand 4 (CCL4) is a 7.66 kDa cytokine with 69 amino acid residues. CCL4, also named macrophage inflammatory protein-1β (MIP-1β), is mainly secreted from neutrophils, monocytes, B cells, T cells, fibroblasts, endothelial cells, and epithelial cells. In addition, CCL4 participates in immune responses, including recruitment of immune cells like lymphocytes, monocytes, and leukocytes, response to IL-1 and IFNγ, and production of TNF when CCL4 binds to CCR5.

Product Info Summary

SKU: PROTP14097-2
Size: 5ug,20ug,100ug
Origin Species: Mouse
Source: Escherichia coli
Application: Cell Culture

Product Name

Mouse recombinant CCL4 (C-C Motif Chemokine Ligand 4) protein, AF

View all CCL4/MIP-1 beta recombinant proteins

SKU/Catalog Number

PROTP14097-2

Size

5ug,20ug,100ug

Tag

His Tag (N-term)

Description

C-C Motif Chemokine Ligand 4 (CCL4) is a 7.66 kDa cytokine with 69 amino acid residues. CCL4, also named macrophage inflammatory protein-1β (MIP-1β), is mainly secreted from neutrophils, monocytes, B cells, T cells, fibroblasts, endothelial cells, and epithelial cells. In addition, CCL4 participates in immune responses, including recruitment of immune cells like lymphocytes, monocytes, and leukocytes, response to IL-1 and IFNγ, and production of TNF when CCL4 binds to CCR5.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Mouse recombinant CCL4 (C-C Motif Chemokine Ligand 4) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP14097-2)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

10.212kDa

Molecular weight

The protein has a calculated MW of 8.64 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to chemoattract human PBMCs using a concentration range of 20.0 - 200.0 ng/mL. Note: Results may vary from different PBMC donors.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN with polyhistidine tag at the N-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For CCL4 (Source: Uniprot.org, NCBI)

Gene Name

CCL4

Full Name

C-C motif chemokine 4

Weight

10.212kDa

Superfamily

intercrine beta (chemokine CC) family

Alternative Names

MIP-1b: Macrophage Inflammatory Protein-1β, ACT-2 CCL4 ACT2, AT744.1, G-26, HC21, LAG-1, LAG1, MIP-1-beta, MIP1B, MIP1B1, SCYA2, SCYA4 C-C motif chemokine ligand 4 C-C motif chemokine 4|G-26 T-lymphocyte-secreted protein|MIP-1-beta(1-69)|PAT 744|SIS-gamma|T-cell activation protein 2|chemokine (C-C motif) ligand 4|lymphocyte activation gene 1 protein|macrophage inflammatory protein 1-beta|secreted protein G-26|small inducible cytokine A4 (homologous to mouse Mip-1b)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CCL4, check out the CCL4 Infographic

CCL4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CCL4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP14097-2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Mouse recombinant CCL4 (C-C Motif Chemokine Ligand 4) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse recombinant CCL4 (C-C Motif Chemokine Ligand 4) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse recombinant CCL4 (C-C Motif Chemokine Ligand 4) protein, AF

Size

Total: $77

SKU:PROTP14097-2

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP14097-2
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.