Product Info Summary
SKU: | PROTP41274 |
---|---|
Size: | 5ug,20ug,100ug |
Origin Species: | Mouse |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant 4-1BBL (4-1BB ligand) protein, AF
View all 4-1BB Ligand/TNFSF9 recombinant proteins
SKU/Catalog Number
PROTP41274
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
4-1BB ligand (4-1BBL) is a type II transmembrane protein that is part of the tumor necrosis factor (TNF) ligand family. As an inducible co-stimulatory molecule, it presents on several antigen presenting cell (APC) types, including B cells, macrophages and DCs. The interactions between 4-1BB and 4-1BBL trigger pleiotropic effects on the immune response including antigen presenting process, proliferation of CD4 and CD8 positive T-cells, as well as cytokine secretion from T-cells through NFκB, c-Jun, and p38 downstream signal pathways activation. Therefore, 4-1BB and 4-1BBL are recently used for the immunotherapy of cancer.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant 4-1BBL (4-1BB ligand) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP41274)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
26.625kDa
Molecular weight
The protein has a calculated MW of 23.9 kDa. The protein migrates as 24 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce IL-2 secretion in mouse T cells in the presence of the anti-CD3 antibody. The ED₅₀ for this effect is <0.05 μg/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MRTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse 41BBL
Protein Target Info & Infographic
Gene/Protein Information For Tnfsf9 (Source: Uniprot.org, NCBI)
Gene Name
Tnfsf9
Full Name
Tumor necrosis factor ligand superfamily member 9
Weight
26.625kDa
Superfamily
tumor necrosis factor family
Alternative Names
4-1BB, 4-1BB-, 4-1BB-L, 4-1BBL, AI848817, Cd137, Cd137l, Ly6, Ly63l,tumor necrosis factor (ligand) superfamily, member 9 , Tnfsf9 TNFSF9 4-1BB-L, CD137L, TNLG5A TNF superfamily member 9 tumor necrosis factor ligand superfamily member 9|4-1BB ligand|4-1BBL|homolog of mouse 4-1BB-L|receptor 4-1BB ligand|tumor necrosis factor (ligand) superfamily, member 9|tumor necrosis factor ligand 5A|tumor necrosis factor superfamily member 9
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on Tnfsf9, check out the Tnfsf9 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Tnfsf9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant 4-1BBL (4-1BB ligand) protein, AF (PROTP41274)
Hello CJ!
No publications found for PROTP41274
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant 4-1BBL (4-1BB ligand) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant 4-1BBL (4-1BB ligand) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question