Mouse recombinant 4-1BBL (4-1BB ligand) protein, AF

4-1BB Ligand/TNFSF9 protein, Mouse

4-1BB ligand (4-1BBL) is a type II transmembrane protein that is part of the tumor necrosis factor (TNF) ligand family. As an inducible co-stimulatory molecule, it presents on several antigen presenting cell (APC) types, including B cells, macrophages and DCs. The interactions between 4-1BB and 4-1BBL trigger pleiotropic effects on the immune response including antigen presenting process, proliferation of CD4 and CD8 positive T-cells, as well as cytokine secretion from T-cells through NFκB, c-Jun, and p38 downstream signal pathways activation. Therefore, 4-1BB and 4-1BBL are recently used for the immunotherapy of cancer.

Product Info Summary

SKU: PROTP41274
Size: 5ug,20ug,100ug
Origin Species: Mouse
Source: Escherichia coli
Application: Cell Culture

Product Name

Mouse recombinant 4-1BBL (4-1BB ligand) protein, AF

View all 4-1BB Ligand/TNFSF9 recombinant proteins

SKU/Catalog Number

PROTP41274

Size

5ug,20ug,100ug

Tag

His Tag (C-term)

Description

4-1BB ligand (4-1BBL) is a type II transmembrane protein that is part of the tumor necrosis factor (TNF) ligand family. As an inducible co-stimulatory molecule, it presents on several antigen presenting cell (APC) types, including B cells, macrophages and DCs. The interactions between 4-1BB and 4-1BBL trigger pleiotropic effects on the immune response including antigen presenting process, proliferation of CD4 and CD8 positive T-cells, as well as cytokine secretion from T-cells through NFκB, c-Jun, and p38 downstream signal pathways activation. Therefore, 4-1BB and 4-1BBL are recently used for the immunotherapy of cancer.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Mouse recombinant 4-1BBL (4-1BB ligand) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP41274)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>95% as determined by SDS-PAGE.

Predicted MW

26.625kDa

Molecular weight

The protein has a calculated MW of 23.9 kDa. The protein migrates as 24 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce IL-2 secretion in mouse T cells in the presence of the anti-CD3 antibody. The ED₅₀ for this effect is <0.05 μg/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MRTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For Tnfsf9 (Source: Uniprot.org, NCBI)

Gene Name

Tnfsf9

Full Name

Tumor necrosis factor ligand superfamily member 9

Weight

26.625kDa

Superfamily

tumor necrosis factor family

Alternative Names

4-1BB, 4-1BB-, 4-1BB-L, 4-1BBL, AI848817, Cd137, Cd137l, Ly6, Ly63l,tumor necrosis factor (ligand) superfamily, member 9 , Tnfsf9 TNFSF9 4-1BB-L, CD137L, TNLG5A TNF superfamily member 9 tumor necrosis factor ligand superfamily member 9|4-1BB ligand|4-1BBL|homolog of mouse 4-1BB-L|receptor 4-1BB ligand|tumor necrosis factor (ligand) superfamily, member 9|tumor necrosis factor ligand 5A|tumor necrosis factor superfamily member 9

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Tnfsf9, check out the Tnfsf9 Infographic

Tnfsf9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Tnfsf9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP41274

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Mouse recombinant 4-1BBL (4-1BB ligand) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse recombinant 4-1BBL (4-1BB ligand) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse recombinant 4-1BBL (4-1BB ligand) protein, AF

Size

Total: $77

SKU:PROTP41274

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP41274
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product