Product Info Summary
SKU: | R00102-6 |
---|---|
Size: | 5 µg/vial |
Source: | Yeast |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse IL-6 Recombinant Protein
View all IL-6 recombinant proteins
SKU/Catalog Number
R00102-6
Size
5 µg/vial
Description
Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Mouse IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.
Storage & Handling
Store at -20°C for one year. Avoid repeated freeze-thaw cycles.
Cite This Product
Mouse IL-6 Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # R00102-6)
Form
Lyophilized
Formulation
Lyophilized without carrier protein.
Purity
Ion-exchange chromatography.
Biological Activity and Protein Authenticity
In testing.
Amino Acid Sequence
FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALA ENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQR DTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVT LRSTRQT (187)
Assay dilution & Images
Validation Images & Assay Conditions
![boster box boster box](https://www.bosterbio.com/media/catalog/product/b/o/boster-box.png)
Click image to see more details
Boster Kit Box
Protein Target Info & Infographic
Gene/Protein Information For IL6 (Source: Uniprot.org, NCBI)
Gene Name
IL6
Full Name
Interleukin-6
Weight
Superfamily
IL-6 superfamily
Alternative Names
B cell stimulatory factor-2; B-cell differentiation factor; BSF2; BSF-2; BSF2CTL differentiation factor; CDF; HGFHSFIFNB2Hybridoma growth factor; IFNB2; IFN-beta-2; IL6; IL-6; IL-6B-cell stimulatory factor 2; Interferon beta-2; interleukin 6 (interferon, beta 2); interleukin BSF-2; interleukin-6; MGI-2A IL6 BSF-2, BSF2, CDF, HGF, HSF, IFN-beta-2, IFNB2, IL-6 interleukin 6 interleukin-6|B-cell differentiation factor|B-cell stimulatory factor 2|CTL differentiation factor|hybridoma growth factor|interferon beta-2|interleukin BSF-2
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL6, check out the IL6 Infographic
![IL6 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse IL-6 Recombinant Protein (R00102-6)
Hello CJ!
No publications found for R00102-6
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse IL-6 Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse IL-6 Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question