Click image to see more details
Product Info Summary
| SKU: | R00102-6 |
|---|---|
| Size: | 5 µg/vial |
| Source: | Yeast |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse IL-6 Recombinant Protein
View all IL-6 recombinant proteins
SKU/Catalog Number
R00102-6
Size
5 µg/vial
Description
Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Mouse IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.
Storage & Handling
Store at -20°C for one year. Avoid repeated freeze-thaw cycles.
Cite This Product
Mouse IL-6 Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # R00102-6)
Form
Lyophilized
Formulation
Lyophilized without carrier protein.
Purity
Ion-exchange chromatography.
Predicted MW
23.718kDa
Biological Activity and Protein Authenticity
In testing.
Amino Acid Sequence
FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALA ENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQR DTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVT LRSTRQT (187)
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
Boster Kit Box
Protein Target Info & Infographic
Gene/Protein Information For IL6 (Source: Uniprot.org, NCBI)
Gene Name
IL6
Full Name
Interleukin-6
Weight
23.718kDa
Superfamily
IL-6 superfamily
Alternative Names
Interleukin-6; IL-6; B-cell hybridoma growth factor; Interleukin HP-1; Il6; Il-6 IL6 BSF-2, BSF2, CDF, HGF, HSF, IFN-beta-2, IFNB2, IL-6 interleukin 6 interleukin-6|B-cell differentiation factor|B-cell stimulatory factor 2|CTL differentiation factor|hybridoma growth factor|interferon beta-2|interleukin BSF-2
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL6, check out the IL6 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse IL-6 Recombinant Protein (R00102-6)
Hello CJ!
No publications found for R00102-6
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse IL-6 Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse IL-6 Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
