Mouse IL-6 Recombinant Protein

IL-6 protein,

Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Mouse IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.

Product Info Summary

SKU: R00102-6
Size: 5 µg/vial
Source: Yeast
Application: Cell Culture

Product Name

Mouse IL-6 Recombinant Protein

View all IL-6 recombinant proteins

SKU/Catalog Number

R00102-6

Size

5 µg/vial

Description

Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Mouse IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.

Storage & Handling

Store at -20°C for one year. Avoid repeated freeze-thaw cycles.

Cite This Product

Mouse IL-6 Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # R00102-6)

Form

Lyophilized

Formulation

Lyophilized without carrier protein.

Purity

Ion-exchange chromatography.

Biological Activity and Protein Authenticity

In testing.

Amino Acid Sequence

FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALA ENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQR DTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVT LRSTRQT (187)

Validation Images & Assay Conditions

Gene/Protein Information For IL6 (Source: Uniprot.org, NCBI)

Gene Name

IL6

Full Name

Interleukin-6

Weight

Superfamily

IL-6 superfamily

Alternative Names

B cell stimulatory factor-2; B-cell differentiation factor; BSF2; BSF-2; BSF2CTL differentiation factor; CDF; HGFHSFIFNB2Hybridoma growth factor; IFNB2; IFN-beta-2; IL6; IL-6; IL-6B-cell stimulatory factor 2; Interferon beta-2; interleukin 6 (interferon, beta 2); interleukin BSF-2; interleukin-6; MGI-2A IL6 BSF-2, BSF2, CDF, HGF, HSF, IFN-beta-2, IFNB2, IL-6 interleukin 6 interleukin-6|B-cell differentiation factor|B-cell stimulatory factor 2|CTL differentiation factor|hybridoma growth factor|interferon beta-2|interleukin BSF-2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IL6, check out the IL6 Infographic

IL6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for R00102-6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Mouse IL-6 Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse IL-6 Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse IL-6 Recombinant Protein

$350
Backordered.

Lead time for this item is typically 4 weeks

Get A Quote
In stock
Order Product
R00102-6
$350.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.