MOBKL2B (MOB3B) (NM_024761) Human Recombinant Protein

MOBKL2B protein,

Product Info Summary

SKU: PROTQ86TA1
Size: 20 µg
Source: HEK293T

Product Name

MOBKL2B (MOB3B) (NM_024761) Human Recombinant Protein

View all MOBKL2B recombinant proteins

SKU/Catalog Number

PROTQ86TA1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human MOB1, Mps One Binder kinase activator-like 2B (yeast) (MOBKL2B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MOBKL2B (MOB3B) (NM_024761) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ86TA1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.3 kDa

Amino Acid Sequence

MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVGVPFPKNFLQICMKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEMTSRMCH

Validation Images & Assay Conditions

Gene/Protein Information For MOB3B (Source: Uniprot.org, NCBI)

Gene Name

MOB3B

Full Name

MOB kinase activator 3B

Weight

25.3 kDa

Superfamily

MOB1/phocein family

Alternative Names

Em:AL163192.1; FLJ13204; FLJ23916; Mob1 homolog 2b; MOB1, Mps One Binder kinase activator-like 2B (yeast); MOB3BMGC32960; monopolar spindle 1 binding, MOB1, domain containing; mps one binder kinase activator-like 2B; Protein Mob3B MOB3B C9orf35, MOB1D, MOBKL2B MOB kinase activator 3B MOB kinase activator 3B|MOB kinase activator-like 2B|MOB1, Mps One Binder kinase activator-like 2B|mob1 homolog 2b|monopolar spindle 1 binding, MOB1, domain containing|mps one binder kinase activator-like 2B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MOB3B, check out the MOB3B Infographic

MOB3B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MOB3B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ86TA1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MOBKL2B (MOB3B) (NM_024761) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MOBKL2B (MOB3B) (NM_024761) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MOBKL2B (MOB3B) (NM_024761) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ86TA1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.