MOB4A (MOB1B) (NM_173468) Human Recombinant Protein

MOB4A protein,

Product Info Summary

SKU: PROTQ7L9L4
Size: 20 µg
Source: HEK293T

Product Name

MOB4A (MOB1B) (NM_173468) Human Recombinant Protein

View all MOB4A recombinant proteins

SKU/Catalog Number

PROTQ7L9L4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human MOB1, Mps One Binder kinase activator-like 1A (yeast) (MOBKL1A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MOB4A (MOB1B) (NM_173468) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ7L9L4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.9 kDa

Amino Acid Sequence

MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR

Validation Images & Assay Conditions

Gene/Protein Information For Mob1b (Source: Uniprot.org, NCBI)

Gene Name

Mob1b

Full Name

MOB kinase activator 1B

Weight

24.9 kDa

Superfamily

MOB1/phocein family

Alternative Names

MATS2; MGC33910; Mob1 homolog 1A; MOB1, Mps One Binder kinase activator-like 1A (yeast); Mob1A; Mob1Bmps one binder kinase activator-like 1A; MOB4Amob1A; Protein Mob4A Mob1b|1110003E08Rik, AU015450, B230364F10, Mobk, Mobkl1a|MOB kinase activator 1B|MOB kinase activator 1B|MOB1, Mps One Binder kinase activator-like 1A|mob1 homolog 1A|mps one binder kinase activator-like 1A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Mob1b, check out the Mob1b Infographic

Mob1b infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Mob1b: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ7L9L4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MOB4A (MOB1B) (NM_173468) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MOB4A (MOB1B) (NM_173468) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MOB4A (MOB1B) (NM_173468) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ7L9L4
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.