Product Info Summary
SKU: | PROTP41246 |
---|---|
Size: | 2ug, 10ug, 0.1mg |
Origin Species: | Rabbit |
Source: | Baculovirus, insect cells |
Customers Who Bought This Also Bought
Product info
Product Name
MMP-9 Matrix Metalloproteinase-9 Rabbit Recombinant Protein
View all MMP-9 recombinant proteins
SKU/Catalog Number
PROTP41246
Size
2ug, 10ug, 0.1mg
Description
MMP-9 Rabbit Recombinant is a full length secreted protein (688 amino acids - a.a. 20-707). The MMP-9 is expressed in insect cells and fused to a 30 aa C-terminal Myc-His tag, having a total MW of 79.94kDa. Purified MMP9 protein appears at 95kDa on SDS-PAGE gel due to protein modification.
Storage & Handling
Store at 4°C if entire vial will be used within 2-4 weeks. Store frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Cite This Product
MMP-9 Matrix Metalloproteinase-9 Rabbit Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP41246)
Form
Sterile Filtered clear solution.
Formulation
The MMP-9 solution (0.3mg/ml) contains 50mM Tris, 150mM NaCl, 10% Glycerol, pH 7.5.
Purity
Greater than 85.0% as determined by SDS-PAGE.
Amino Acid Sequence
APRRRQPTLVVFPGELRTRLTDRQLAEEYLFRYGYTRVASMHGDSQSLRLPLLLLQK HLSLPETGELDNATLEAMRAPRCGVPDVGKFQTFEGDLKWHHHNITYWIQNYSEDLP RDVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHA FPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNADGAPCHFPFTFEGRSYTACTTD GRSDGMAWCSTTADYDTDRRFGFCPSERLYTQDGNADGKPCEFPFIFQGRTYSACT TDGRSDGHRWCATTASYDKDKLYGFCPTRADSTVVGGNSAGELCVFPFVFLGKEYS SCTSEGRRDGRLWCATTSNFDSDKKWGFCPDKGYSLFLVAAHEFGHALGLDHSSVP ERLMYPMYRYLEGSPLHEDDVRGIQHLYGPNPNPQPPATTTPEPQPTAPPTACPTWP ATVRPSEHPTTSPTGAPSAGPTGPPTASPSAAPTASLDPAEDVCNVNVFDAIAEIGNK LHVFKDGRYWRFSEGSGRRPQGPFLIADTWPALPAKLDSAFEEPLTKKLFFFSGRQV WVYTGASVLGPRRLDKLGLGPEVPHVTGALPRAGGKVLLFGAQRFWRFDVKTQTVD SRSGAPVDQMFPGVPLNTHDVFQYREKAYFCQDRFFWRVSTRNEVNLVDQVGYVS FDILHCPED
Assay dilution & Images
Validation Images & Assay Conditions
![recombinant protein thumbnail_1 recombinant protein thumbnail_1](https://www.bosterbio.com/media/catalog/product/r/e/recombinant-protein-thumbnail_1.png)
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For MMP9 (Source: Uniprot.org, NCBI)
Gene Name
MMP9
Full Name
Matrix metalloproteinase-9
Weight
Superfamily
peptidase M10A family
Alternative Names
92 kDa gelatinase; 92 kDa type IV collagenase; CLG4B; EC 3.4.24; EC 3.4.24.35; Gelatinase B; GELB; macrophage gelatinase; MANDP2; matrix metallopeptidase 9; matrix metalloproteinase 9; matrix metalloproteinase-9; MMP9; MMP-9; type V collagenase MMP9 CLG4B, GELB, MANDP2, MMP-9 matrix metallopeptidase 9 matrix metalloproteinase-9|macrophage gelatinase|matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)|matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)|type V collagenase
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on MMP9, check out the MMP9 Infographic
![MMP9 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for MMP9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For MMP-9 Matrix Metalloproteinase-9 Rabbit Recombinant Protein (PROTP41246)
Hello CJ!
No publications found for PROTP41246
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used MMP-9 Matrix Metalloproteinase-9 Rabbit Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For MMP-9 Matrix Metalloproteinase-9 Rabbit Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question