MMACHC (NM_015506) Human Recombinant Protein

MMACHC protein,

Product Info Summary

SKU: PROTQ9Y4U1
Size: 20 µg
Source: HEK293T

Product Name

MMACHC (NM_015506) Human Recombinant Protein

View all MMACHC recombinant proteins

SKU/Catalog Number

PROTQ9Y4U1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria (MMACHC)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MMACHC (NM_015506) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y4U1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

31.5 kDa

Amino Acid Sequence

MEPKVAELKQKIEDTLCPFGFEVYPFQVAWYNELLPPAFHLPLPGPTLAFLVLSTPAMFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSWLSPRVSPPASPGP

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For MMACHC (Source: Uniprot.org, NCBI)

Gene Name

MMACHC

Full Name

Methylmalonic aciduria and homocystinuria type C protein

Weight

31.5 kDa

Superfamily

MMACHC family

Alternative Names

cblC; DKFZP564I122; FLJ25671; methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria; methylmalonic aciduria and homocystinuria type C protein; RP11-291L19.3 MMACHC cblC metabolism of cobalamin associated C cyanocobalamin reductase / alkylcobalamin dealkylase|alkylcobalamin:glutathione S-alkyltransferase|cyanocobalamin reductase (cyanide-eliminating)|methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria|methylmalonic aciduria and homocystinuria type C protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MMACHC, check out the MMACHC Infographic

MMACHC infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MMACHC: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y4U1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MMACHC (NM_015506) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MMACHC (NM_015506) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MMACHC (NM_015506) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y4U1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product