MMAB (NM_052845) Human Recombinant Protein

Mmab protein,

Product Info Summary

SKU: PROTQ96EY8
Size: 20 µg
Source: HEK293T

Product Name

MMAB (NM_052845) Human Recombinant Protein

View all Mmab recombinant proteins

SKU/Catalog Number

PROTQ96EY8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human methylmalonic aciduria (cobalamin deficiency) cblB type (MMAB), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MMAB (NM_052845) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96EY8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24 kDa

Amino Acid Sequence

MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL

Validation Images & Assay Conditions

Gene/Protein Information For MMAB (Source: Uniprot.org, NCBI)

Gene Name

MMAB

Full Name

Corrinoid adenosyltransferase

Weight

24 kDa

Superfamily

Cob(I)alamin adenosyltransferase family

Alternative Names

aquocob(I)alamin vitamin B12s adenosyltransferase; ATP:cob(I)alamin adenosyltransferase; ATP:corrinoid adenosyltransferase; ATR; cblB; c-diamide adenosyltransferase, mitochondrial; cob; Cob(I)alamin adenosyltransferase; cob(I)yrinic acid a; EC 2.5.1.17; methylmalonic aciduria (cobalamin deficiency) cblB type; methylmalonic aciduria (cobalamin deficiency) type B; Methylmalonic aciduria type B protein; MGC20496 Mmab|9130222L19Rik, ATR|methylmalonic aciduria (cobalamin deficiency) cblB type homolog (human)|corrinoid adenosyltransferase|ATP:cob(I)alamin adenosyltransferase|cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial|cob(II)alamin adenosyltransferase|cob(II)yrinic acid a,c-diamide adenosyltransferase|cobinamide/cobalamin adenosyltransferase|methylmalonic aciduria (cobalamin deficiency) type B homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MMAB, check out the MMAB Infographic

MMAB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MMAB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96EY8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MMAB (NM_052845) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MMAB (NM_052845) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MMAB (NM_052845) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96EY8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product