Mitocondrial Translational Initiation Factor 3 (MTIF3) (NM_152912) Human Recombinant Protein

Mitocondrial Translational Initiation Factor 3 protein,

Recombinant protein of human mitochondrial translational initiation factor 3 (MTIF3), nuclear gene encoding mitochondrial protein

Product Info Summary

SKU: PROTQ9H2K0
Size: 20 µg
Source: HEK293T

Product Name

Mitocondrial Translational Initiation Factor 3 (MTIF3) (NM_152912) Human Recombinant Protein

View all Mitocondrial Translational Initiation Factor 3 recombinant proteins

SKU/Catalog Number

PROTQ9H2K0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mitochondrial translational initiation factor 3 (MTIF3), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Mitocondrial Translational Initiation Factor 3 (MTIF3) (NM_152912) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H2K0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

31.5 kDa

Amino Acid Sequence

MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKIKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ

Validation Images & Assay Conditions

Gene/Protein Information For Mtif3 (Source: Uniprot.org, NCBI)

Gene Name

Mtif3

Full Name

Translation initiation factor IF-3, mitochondrial

Weight

31.5 kDa

Superfamily

IF-3 family

Alternative Names

FLJ33676; IF3(mt); IF-3mt; mitochondrial translational initiation factor 3; mitochondrial

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Mtif3, check out the Mtif3 Infographic

Mtif3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Mtif3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H2K0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Mitocondrial Translational Initiation Factor 3 (MTIF3) (NM_152912) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mitocondrial Translational Initiation Factor 3 (MTIF3) (NM_152912) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mitocondrial Translational Initiation Factor 3 (MTIF3) (NM_152912) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H2K0
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.