MIOX (NM_017584) Human Recombinant Protein

MIOX protein,

Product Info Summary

SKU: PROTQ9UGB7
Size: 20 µg
Source: HEK293T

Product Name

MIOX (NM_017584) Human Recombinant Protein

View all MIOX recombinant proteins

SKU/Catalog Number

PROTQ9UGB7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human myo-inositol oxygenase (MIOX)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MIOX (NM_017584) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UGB7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

32.8 kDa

Amino Acid Sequence

MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSW

Validation Images & Assay Conditions

Gene/Protein Information For MIOX (Source: Uniprot.org, NCBI)

Gene Name

MIOX

Full Name

Inositol oxygenase

Weight

32.8 kDa

Superfamily

myo-inositol oxygenase family

Alternative Names

aldehyde reductase (aldose reductase) like 6; Aldehyde reductase-like 6; ALDRL6; inositol oxygenase; Kidney-specific protein 32; KSP32; MGC90217; MI oxygenase; myo-inositol oxygenaseEC 1.13.99.1; Renal-specific oxidoreductase; RSOR MIOX ALDRL6 myo-inositol oxygenase inositol oxygenase|MI oxygenase|aldehyde reductase (aldose reductase) like 6|aldehyde reductase-like 6|kidney-specific protein 32|renal-specific oxidoreductase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MIOX, check out the MIOX Infographic

MIOX infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MIOX: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UGB7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MIOX (NM_017584) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MIOX (NM_017584) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MIOX (NM_017584) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UGB7
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.