MID1IP1 (NM_021242) Human Recombinant Protein

MID1IP1 protein,

Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 1

Product Info Summary

SKU: PROTQ9NPA3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MID1IP1 (NM_021242) Human Recombinant Protein

View all MID1IP1 recombinant proteins

SKU/Catalog Number

PROTQ9NPA3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MID1IP1 (NM_021242) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NPA3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20 kDa

Amino Acid Sequence

MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH

Validation Images & Assay Conditions

Gene/Protein Information For MID1IP1 (Source: Uniprot.org, NCBI)

Gene Name

MID1IP1

Full Name

Mid1-interacting protein 1

Weight

20 kDa

Superfamily

SPOT14 family

Alternative Names

FLJ10386; G12-like; Gastrulation-specific G12-like protein; MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)); MID1 interacting protein 1 (gastrulation specific G12-like (zebrafish)); MID1 interacting protein 1 (gastrulation specific G12-like); Mid1-interacting G12-like protein; mid1-interacting protein 1; MIG12MID1 interacting G12-like protein; Protein STRAIT11499; S14R; Spot 14-R; Spot 14-related protein; STRAIT11499; THRSPL MID1IP1 G12-like, MIG12, S14R, STRAIT11499, THRSPL MID1 interacting protein 1 mid1-interacting protein 1|MID1 interacting G12-like protein|MID1 interacting protein 1 (gastrulation specific G12-like)|gastrulation specific G12 homolog|spot 14-R|spot 14-related protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MID1IP1, check out the MID1IP1 Infographic

MID1IP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MID1IP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NPA3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MID1IP1 (NM_021242) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MID1IP1 (NM_021242) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MID1IP1 (NM_021242) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NPA3
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.