METTL9 (NM_001077180) Human Recombinant Protein

METTL9 protein,

Recombinant protein of human methyltransferase like 9 (METTL9), transcript variant 2

Product Info Summary

SKU: PROTQ9H1A3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

METTL9 (NM_001077180) Human Recombinant Protein

View all METTL9 recombinant proteins

SKU/Catalog Number

PROTQ9H1A3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human methyltransferase like 9 (METTL9), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

METTL9 (NM_001077180) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H1A3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.3 kDa

Amino Acid Sequence

MRLLAGWLCLSLASVWLARRMWTLRSPLTRSLYVNMTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV

Validation Images & Assay Conditions

Gene/Protein Information For METTL9 (Source: Uniprot.org, NCBI)

Gene Name

METTL9

Full Name

Methyltransferase-like protein 9

Weight

36.3 kDa

Superfamily

DREV family

Alternative Names

Methyltransferase-like protein 9 METTL9 CGI-81, DREV, DREV1, PAP1 methyltransferase like 9 methyltransferase-like protein 9|CTB-31N19.3|DORA reverse strand protein 1|p53 activated protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on METTL9, check out the METTL9 Infographic

METTL9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for METTL9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H1A3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used METTL9 (NM_001077180) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For METTL9 (NM_001077180) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for METTL9 (NM_001077180) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H1A3
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.