Methionyl Aminopeptidase 1 (METAP1) (NM_015143) Human Recombinant Protein

Methionine Aminopeptidase 1/METAP1 protein,

Product Info Summary

SKU: PROTP53582
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Methionyl Aminopeptidase 1 (METAP1) (NM_015143) Human Recombinant Protein

View all Methionine Aminopeptidase 1/METAP1 recombinant proteins

SKU/Catalog Number

PROTP53582

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human methionyl aminopeptidase 1 (METAP1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Methionyl Aminopeptidase 1 (METAP1) (NM_015143) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP53582)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

43 kDa

Amino Acid Sequence

MSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMSQF

Validation Images & Assay Conditions

Gene/Protein Information For METAP1 (Source: Uniprot.org, NCBI)

Gene Name

METAP1

Full Name

Methionine aminopeptidase 1

Weight

43 kDa

Superfamily

peptidase M24A family

Alternative Names

DKFZp781C0419; EC 3.4.11.18; KIAA0094MAP 1; MAP1; MAP1A; MetAP 1; MetAP1; MetAP1A; Methionine Aminopeptidase 1; methionyl aminopeptidase 1; Peptidase M 1 METAP1 MAP1A, MetAP1A methionyl aminopeptidase 1 methionine aminopeptidase 1|MAP 1|metAP 1|peptidase M 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on METAP1, check out the METAP1 Infographic

METAP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for METAP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP53582

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Methionyl Aminopeptidase 1 (METAP1) (NM_015143) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Methionyl Aminopeptidase 1 (METAP1) (NM_015143) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Methionyl Aminopeptidase 1 (METAP1) (NM_015143) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP53582
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.