Meis homeobox 3 (MEIS3) (NM_020160) Human Recombinant Protein

Meis homeobox 3 protein,

Product Info Summary

SKU: PROTQ99687
Size: 20 µg
Source: HEK293T

Product Name

Meis homeobox 3 (MEIS3) (NM_020160) Human Recombinant Protein

View all Meis homeobox 3 recombinant proteins

SKU/Catalog Number

PROTQ99687

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human Meis homeobox 3 (MEIS3), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Meis homeobox 3 (MEIS3) (NM_020160) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99687)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

46 kDa

Amino Acid Sequence

MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSRRSEAPVLPDVCLGLGSPSPGPRWARPWGSDCGRPGRQSDSCWWLQHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL

Validation Images & Assay Conditions

Gene/Protein Information For MEIS3 (Source: Uniprot.org, NCBI)

Gene Name

MEIS3

Full Name

Homeobox protein Meis3

Weight

46 kDa

Superfamily

TALE/MEIS homeobox family

Alternative Names

DKFZp547H236; Meis homeobox 3; Meis1, myeloid ecotropic viral integration site 1 homolog 3 (mouse); Meis1, myeloid ecotropic viral integration site 1 homolog 3; Meis1-related protein 2; MRG2homeobox protein Meis3 Meis3|AI573393, Mrg, Mrg2|Meis homeobox 3|homeobox protein Meis3|meis1-related protein 2|myeloid ecotropic viral integration site-related gene 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MEIS3, check out the MEIS3 Infographic

MEIS3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MEIS3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ99687

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Meis homeobox 3 (MEIS3) (NM_020160) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Meis homeobox 3 (MEIS3) (NM_020160) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Meis homeobox 3 (MEIS3) (NM_020160) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ99687
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.