MAP6D1 (NM_024871) Human Recombinant Protein

MAP6D1 protein,

Purified recombinant protein of Homo sapiens MAP6 domain containing 1 (MAP6D1)

Product Info Summary

SKU: PROTQ9H9H5
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MAP6D1 (NM_024871) Human Recombinant Protein

View all MAP6D1 recombinant proteins

SKU/Catalog Number

PROTQ9H9H5

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens MAP6 domain containing 1 (MAP6D1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MAP6D1 (NM_024871) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H9H5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.8 kDa

Amino Acid Sequence

MAWPCISRLCCLARRWNQLDRSDVAVPLTLHGYSDLDSEEPGTGGAASRRGQPPAGARDSGRDVPLTQYQRDFGLWTTPAGPKDPPPGRGPGAGGRRGKSSAQSSAPPAPGARGVYVLPIGDADAAAAVTTSYRQEFQAWTGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQVPEVRKKFTPNPSAIFQASAPRILNV

Validation Images & Assay Conditions

Gene/Protein Information For MAP6D1 (Source: Uniprot.org, NCBI)

Gene Name

MAP6D1

Full Name

MAP6 domain-containing protein 1

Weight

20.8 kDa

Superfamily

STOP family

Alternative Names

FLJ12748; MAP6 domain containing 1; MAP6 domain-containing protein 1,21 kDa STOP-like protein; MAPO6D1; SL21; STOP-like protein 21 MAP6D1 MAPO6D1, SL21 MAP6 domain containing 1 MAP6 domain-containing protein 1|21 kDa STOP-like protein|STOP-Like protein 21 kD

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MAP6D1, check out the MAP6D1 Infographic

MAP6D1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MAP6D1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H9H5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MAP6D1 (NM_024871) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MAP6D1 (NM_024871) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MAP6D1 (NM_024871) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H9H5
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.