MANBAL (NM_022077) Human Recombinant Protein

MANBAL protein,

Recombinant protein of human mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 1

Product Info Summary

SKU: PROTQ9NQG1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MANBAL (NM_022077) Human Recombinant Protein

View all MANBAL recombinant proteins

SKU/Catalog Number

PROTQ9NQG1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MANBAL (NM_022077) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NQG1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

9.3 kDa

Amino Acid Sequence

MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAVPSVNKRPKKETKKKR

Validation Images & Assay Conditions

Gene/Protein Information For MANBAL (Source: Uniprot.org, NCBI)

Gene Name

MANBAL

Full Name

Protein MANBAL

Weight

9.3 kDa

Superfamily

UPF0239 family

Alternative Names

Protein MANBAL MANBAL mannosidase beta like protein MANBAL|mannosidase beta A like|mannosidase, beta A, lysosomal-like

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MANBAL, check out the MANBAL Infographic

MANBAL infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MANBAL: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NQG1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MANBAL (NM_022077) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MANBAL (NM_022077) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MANBAL (NM_022077) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NQG1
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.