MAL (NM_002371) Human Recombinant Protein

MAL protein,

Recombinant protein of human mal, T-cell differentiation protein (MAL), transcript variant a

Product Info Summary

SKU: PROTP21145
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MAL (NM_002371) Human Recombinant Protein

View all MAL recombinant proteins

SKU/Catalog Number

PROTP21145

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mal, T-cell differentiation protein (MAL), transcript variant a

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MAL (NM_002371) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP21145)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.5 kDa

Amino Acid Sequence

MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS

Validation Images & Assay Conditions

Gene/Protein Information For MAL (Source: Uniprot.org, NCBI)

Gene Name

MAL

Full Name

Myelin and lymphocyte protein

Weight

16.5 kDa

Superfamily

MAL family

Alternative Names

mal, T-cell differentiation protein; myelin and lymphocyte protein; T-cell differentiation protein MAL; T-lymphocyte maturation-associated protein MAL MVP17, VIP17 mal, T cell differentiation protein myelin and lymphocyte protein|T-lymphocyte maturation-associated protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MAL, check out the MAL Infographic

MAL infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MAL: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP21145

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MAL (NM_002371) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MAL (NM_002371) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MAL (NM_002371) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP21145
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.