LSM5 (NM_012322) Human Recombinant Protein

LSM5 protein,

Product Info Summary

SKU: PROTQ9Y4Y9
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LSM5 (NM_012322) Human Recombinant Protein

View all LSM5 recombinant proteins

SKU/Catalog Number

PROTQ9Y4Y9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LSM5 (NM_012322) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y4Y9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

9.8 kDa

Amino Acid Sequence

MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV

Validation Images & Assay Conditions

Gene/Protein Information For LSM5 (Source: Uniprot.org, NCBI)

Gene Name

LSM5

Full Name

U6 snRNA-associated Sm-like protein LSm5

Weight

9.8 kDa

Superfamily

snRNP Sm proteins family

Alternative Names

U6 snRNA-associated Sm-like protein LSm5 LSM5 YER146W LSM5 homolog, U6 small nuclear RNA and mRNA degradation associated U6 snRNA-associated Sm-like protein LSm5|LSM5 U6 small nuclear RNA and mRNA degradation associated|LSM5 homolog, U6 small nuclear RNA associated

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LSM5, check out the LSM5 Infographic

LSM5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LSM5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y4Y9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LSM5 (NM_012322) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LSM5 (NM_012322) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LSM5 (NM_012322) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y4Y9
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.