LSM14A (NM_015578) Human Recombinant Protein

LSM14A protein,

Recombinant protein of human LSM14A, SCD6 homolog A (S. cerevisiae) (LSM14A), transcript variant 2

Product Info Summary

SKU: PROTQ8ND56
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LSM14A (NM_015578) Human Recombinant Protein

View all LSM14A recombinant proteins

SKU/Catalog Number

PROTQ8ND56

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human LSM14A, SCD6 homolog A (S. cerevisiae) (LSM14A), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LSM14A (NM_015578) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8ND56)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

50.4 kDa

Amino Acid Sequence

MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGSSTSSFQSMGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVSTRPLPSASQKAGENQEHRRAEVHKVSRPENEQLRNDNKRQVAPGAPSAPRRGRGGHRGGRGRFGIRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGGRGRGGGRGGTFTAPRGFRGGFRGGRGGREFADFEYRKDNKVAA

Validation Images & Assay Conditions

Gene/Protein Information For LSM14A (Source: Uniprot.org, NCBI)

Gene Name

LSM14A

Full Name

Protein LSM14 homolog A

Weight

50.4 kDa

Superfamily

LSM14 family

Alternative Names

alphaSNBP; C19orf13; DKFZP434D1335; FAM61A; family with sequence similarity 61, member A; hRAP55; hRAP55A; LSM14 homolog A; LSM14A, SCD6 homolog A (S. cerevisiae); Protein FAM61A; protein LSM14 homolog A; Protein SCD6 homolog; Putative alpha-synuclein-binding protein; RAP55ALSM14 homolog A (SCD6, S. cerevisiae); RAP55chromosome 19 open reading frame 13; RNA-associated protein 55; RNA-associated protein 55A LSM14A C19orf13, FAM61A, RAP55, RAP55A LSM14A mRNA processing body assembly factor protein LSM14 homolog A|LSM14 homolog A|LSM14A, SCD6 homolog A|RNA-associated protein 55|RNA-associated protein 55A|alphaSNBP|family with sequence similarity 61, member A|hRAP55|hRAP55A|protein SCD6 homolog|putative alpha-synuclein-binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LSM14A, check out the LSM14A Infographic

LSM14A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LSM14A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8ND56

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LSM14A (NM_015578) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LSM14A (NM_015578) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LSM14A (NM_015578) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8ND56
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.