LRRC51 (NM_145309) Human Recombinant Protein

LRTOMT protein,

Recombinant protein of human leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 1

Product Info Summary

SKU: PROTQ8WZ04
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LRRC51 (NM_145309) Human Recombinant Protein

View all LRTOMT recombinant proteins

SKU/Catalog Number

PROTQ8WZ04

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LRRC51 (NM_145309) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8WZ04)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22 kDa

Amino Acid Sequence

MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPVLTTFFNLSVLYLHGNSIQRLGEVNKLAVLPRLRSLTLHGNPMEEEKGYRQYVLCTLSRITTFDFSGVTKADRTTAEVWKRMNIKPKKAWTKQNTL

Validation Images & Assay Conditions

Gene/Protein Information For LRTOMT (Source: Uniprot.org, NCBI)

Gene Name

LRTOMT

Full Name

Transmembrane O-methyltransferase

Weight

22 kDa

Superfamily

class I-like SAM-binding methyltransferase superfamily

Alternative Names

leucine rich transmembrane and 0-methyltransferase domain containing; TOMT LRTOMT CFAP111, DFNB63, LRRC51 leucine rich transmembrane and O-methyltransferase domain containing transmembrane O-methyltransferase|leucine rich transmembrane and 0-methyltransferase domain containing

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LRTOMT, check out the LRTOMT Infographic

LRTOMT infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LRTOMT: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8WZ04

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LRRC51 (NM_145309) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LRRC51 (NM_145309) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LRRC51 (NM_145309) Human Recombinant Protein

$1249
In stock, 1 left.

Order within 77 hours and 26 minutes to receive by Tue Nov 26

Get A Quote
In stock
Order Product
PROTQ8WZ04
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.