LRRC46 (NM_033413) Human Recombinant Protein

Lrrc46 protein,

Recombinant protein of human leucine rich repeat containing 46 (LRRC46)

Product Info Summary

SKU: PROTQ96FV0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LRRC46 (NM_033413) Human Recombinant Protein

View all Lrrc46 recombinant proteins

SKU/Catalog Number

PROTQ96FV0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human leucine rich repeat containing 46 (LRRC46)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LRRC46 (NM_033413) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96FV0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35.2 kDa

Amino Acid Sequence

MSGGKSAQGPEEGGVCITEALITKRNLTFPEDGELSEKMFHTLDELQTVRLDREGITTIRNLEGLQNLHSLYLQGNKIQQIENLACIPSLRFLSLAGNQIRQVENLLDLPCLQFLDLSENLIETLKLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLDGQPVVERWISDEEDEASSDEEFPELSGPFCSERGFLKELEQELSRHREHRQQTALTEHLLRMEMQPTLTDLPLLPGVPMAGDSSPSATPAQGEETVPEAVSSPQASSPTKKPCSLIPRGHQSSFWGRKGARAATAPKASVAEAPSTTKTTAKRSKK

Validation Images & Assay Conditions

Gene/Protein Information For Lrrc46 (Source: Uniprot.org, NCBI)

Gene Name

Lrrc46

Full Name

Leucine-rich repeat-containing protein 46

Weight

35.2 kDa

Alternative Names

FLJ23553; leucine rich repeat containing 46; leucine-rich repeat-containing protein 46; MGC16309

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Lrrc46, check out the Lrrc46 Infographic

Lrrc46 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Lrrc46: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96FV0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LRRC46 (NM_033413) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LRRC46 (NM_033413) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LRRC46 (NM_033413) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96FV0
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.