LRP15 (LRRC3B) (NM_052953) Human Recombinant Protein

LRRC3B/LRP15 protein,

Recombinant protein of human leucine rich repeat containing 3B (LRRC3B)

Product Info Summary

SKU: PROTQ96PB8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LRP15 (LRRC3B) (NM_052953) Human Recombinant Protein

View all LRRC3B/LRP15 recombinant proteins

SKU/Catalog Number

PROTQ96PB8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human leucine rich repeat containing 3B (LRRC3B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LRP15 (LRRC3B) (NM_052953) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96PB8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

29.1 kDa

Amino Acid Sequence

MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV

Validation Images & Assay Conditions

Gene/Protein Information For LRRC3B (Source: Uniprot.org, NCBI)

Gene Name

LRRC3B

Full Name

Leucine-rich repeat-containing protein 3B

Weight

29.1 kDa

Superfamily

LRRC3 family

Alternative Names

leucine rich repeat containing 3B; leucine-rich repeat-containing protein 3B; LRP15; LRP15Leucine-rich repeat protein LRP15; LRRC3B; MGC102927 LRRC3B LRP15 leucine rich repeat containing 3B leucine-rich repeat-containing protein 3B|leucine-rich repeat protein 15|leucine-rich repeat protein LRP15

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LRRC3B, check out the LRRC3B Infographic

LRRC3B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LRRC3B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96PB8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LRP15 (LRRC3B) (NM_052953) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LRP15 (LRRC3B) (NM_052953) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LRP15 (LRRC3B) (NM_052953) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96PB8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.