LITAF (NM_004862) Human Recombinant Protein

LITAF protein,

Product Info Summary

SKU: PROTQ99732
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LITAF (NM_004862) Human Recombinant Protein

View all LITAF recombinant proteins

SKU/Catalog Number

PROTQ99732

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human lipopolysaccharide-induced TNF factor (LITAF), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LITAF (NM_004862) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99732)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.9 kDa

Amino Acid Sequence

MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL

Validation Images & Assay Conditions

Gene/Protein Information For LITAF (Source: Uniprot.org, NCBI)

Gene Name

LITAF

Full Name

Lipopolysaccharide-induced tumor necrosis factor-alpha factor

Weight

16.9 kDa

Superfamily

CDIP1/LITAF family

Alternative Names

CMT1C; FLJ38636; lipopolysaccharide-induced TNF factor; lipopolysaccharide-induced TNF-alpha factor; lipopolysaccharide-induced tumor necrosis factor-alpha factor; LITAF; LPS-induced TNF-alpha factor; MGC116698; MGC116700; MGC125275; MGC125276; p53-induced gene 7 protein; PIG7; PIG7MGC116701; SIMPLE; SIMPLEMGC125274; Small integral membrane protein of lysosome/late endosome; TP53I7; tumor protein p53 inducible protein 7 LITAF PIG7, SIMPLE, TP53I7 lipopolysaccharide induced TNF factor lipopolysaccharide-induced tumor necrosis factor-alpha factor|LPS-induced TNF-alpha factor|lipopolysaccharide-induced TNF-alpha factor|p53-induced gene 7 protein|small integral membrane protein of lysosome/late endosome|tumor protein p53 inducible protein 7

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LITAF, check out the LITAF Infographic

LITAF infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LITAF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ99732

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LITAF (NM_004862) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LITAF (NM_004862) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LITAF (NM_004862) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ99732
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.