LHFPL2 (NM_005779) Human Recombinant Protein

LHFPL2 protein,

Recombinant protein of human lipoma HMGIC fusion partner-like 2 (LHFPL2)

Product Info Summary

SKU: PROTQ6ZUX7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LHFPL2 (NM_005779) Human Recombinant Protein

View all LHFPL2 recombinant proteins

SKU/Catalog Number

PROTQ6ZUX7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human lipoma HMGIC fusion partner-like 2 (LHFPL2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LHFPL2 (NM_005779) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6ZUX7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.3 kDa

Amino Acid Sequence

MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRNPGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLICLL

Validation Images & Assay Conditions

Gene/Protein Information For LHFPL2 (Source: Uniprot.org, NCBI)

Gene Name

LHFPL2

Full Name

LHFPL tetraspan subfamily member 2 protein

Weight

24.3 kDa

Superfamily

LHFP family

Alternative Names

DKFZp781E0375; KIAA0206; LHFP-like protein 2; lipoma HMGIC fusion partner-like 2 protein; lipoma HMGIC fusion partner-like 2 LHFPL2 LHFPL tetraspan subfamily member 2 LHFPL tetraspan subfamily member 2 protein|LHFP-like protein 2|lipoma HMGIC fusion partner-like 2 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LHFPL2, check out the LHFPL2 Infographic

LHFPL2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LHFPL2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6ZUX7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LHFPL2 (NM_005779) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LHFPL2 (NM_005779) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LHFPL2 (NM_005779) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6ZUX7
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.