LD78 beta (CCL3L1) (NM_021006) Human Recombinant Protein

CCL3L1/LD78 beta protein,

Product Info Summary

SKU: PROTP16619
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LD78 beta (CCL3L1) (NM_021006) Human Recombinant Protein

View all CCL3L1/LD78 beta recombinant proteins

SKU/Catalog Number

PROTP16619

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chemokine (C-C motif) ligand 3-like 1 (CCL3L1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LD78 beta (CCL3L1) (NM_021006) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP16619)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

7.7 kDa

Amino Acid Sequence

MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA

Validation Images & Assay Conditions

Gene/Protein Information For CCL3L1 (Source: Uniprot.org, NCBI)

Gene Name

CCL3L1

Full Name

C-C motif chemokine 3-like 1

Weight

7.7 kDa

Superfamily

intercrine beta (chemokine CC) family

Alternative Names

C-C motif chemokine 3-like 1; CCL3L3; chemokine (C-C motif) ligand 3-like 1; D17S1718; G0/G1 switch regulatory protein 19-2; G0S19-2LD78; LD78BETA; LD78-beta(1-70); MGC104178; MGC12815; MGC182017; MIP1AP; PAT 464.2; SCYA3L; SCYA3L1464.2; small inducible cytokine A3-like 1; Small-inducible cytokine A3-like 1; Tonsillar lymphocyte LD78 beta protein CCL3L1 464.2, D17S1718, G0S19-2, LD78, LD78-beta(1-70), LD78BETA, MIP1AP, SCYA3L, SCYA3L1 C-C motif chemokine ligand 3 like 1 C-C motif chemokine 3-like 1|G0/G1 switch regulatory protein 19-2|chemokine (C-C motif) ligand 3-like 1|small inducible cytokine A3-like 1|tonsillar lymphocyte LD78 beta protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CCL3L1, check out the CCL3L1 Infographic

CCL3L1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CCL3L1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP16619

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LD78 beta (CCL3L1) (NM_021006) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LD78 beta (CCL3L1) (NM_021006) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LD78 beta (CCL3L1) (NM_021006) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP16619
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product