LBX1 (NM_006562) Human Recombinant Protein

LBX1 protein,

Recombinant protein of human ladybird homeobox 1 (LBX1)

Product Info Summary

SKU: PROTP52954
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LBX1 (NM_006562) Human Recombinant Protein

View all LBX1 recombinant proteins

SKU/Catalog Number

PROTP52954

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ladybird homeobox 1 (LBX1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LBX1 (NM_006562) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP52954)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30 kDa

Amino Acid Sequence

MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPPGAPKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVDD

Validation Images & Assay Conditions

Gene/Protein Information For LBX1 (Source: Uniprot.org, NCBI)

Gene Name

LBX1

Full Name

Transcription factor LBX1

Weight

30 kDa

Alternative Names

homeobox; HPX6; HPX-6; ladybird homeobox 1; ladybird homeobox homolog 1 (Drosophila); ladybird homeobox homolog 1; Ladybird homeobox protein homolog 1; LBX1Hlady bird-like homeobox; transcription factor LBX1; transcription factor similar to D. melanogaster homeodomain protein lady birdlate LBX1 HPX-6, HPX6H, homeobox, LBX1 ladybird homeobox 1 transcription factor LBX1|lady bird-like homeobox|ladybird homeobox homolog 1|ladybird homeobox protein homolog 1|transcription factor similar to D. melanogaster homeodomain protein lady bird late

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LBX1, check out the LBX1 Infographic

LBX1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LBX1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP52954

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LBX1 (NM_006562) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LBX1 (NM_006562) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LBX1 (NM_006562) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP52954
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.